TSTD2 Peptide - N-terminal region
TSTD2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C9orf97
UniProt
Q5T7W7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TSTD2 Rabbit Polyclonal Antibody (orb55776) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_640339.4
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DLKDMSLINPSSSLKAELDGSTKKKYSFAKKKAFALFVKTKEVPTKRSFE
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-6888R-BF750 100 µL
BRCC3 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
Sign In for Pricing
View Details 
PC1005717-01 250 mg
5-Methyl-2-phenyl-4- (2,2,2-trifluoroacetyl) -1H-pyrazol-3 (2H) -one
Sign In for Pricing
View Details 
PC1005717-02 1 g
5-Methyl-2-phenyl-4- (2,2,2-trifluoroacetyl) -1H-pyrazol-3 (2H) -one
Sign In for Pricing
View Details 
PC1005717-03 5 g
5-Methyl-2-phenyl-4- (2,2,2-trifluoroacetyl) -1H-pyrazol-3 (2H) -one
Sign In for Pricing
View Details