Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGEF10L Peptide - C-terminal region

ARHGEF10L Peptide - C-terminal region

Product Specifications

Product Name Alternative

GrinchGEF

UniProt

Q9HCE6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARHGEF10L Rabbit Polyclonal Antibody (orb589158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001011722.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SILAPDILRSDQEEAEGPRAEEDKPDGQAHEPMPDSHVGRELTRKKGILL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034UC-01 25 µg

FITC Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
FITC Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034UC-02 100 µg

FITC Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
P-Desthioxo, P-Oxo Bensulide
TRC-B365945-500MG 500 mg

P-Desthioxo, P-Oxo Bensulide

Sign In for Pricing
View Details
Hif1a Mouse Gene Knockout Kit (CRISPR)
KN307708 1 Kit

Hif1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cyclohexanol
TRC-C987960-500ML 500 mL

Cyclohexanol

Sign In for Pricing
View Details
MNK1 (MKNK1) Rabbit Polyclonal Antibody
TA361328 100 µL

MNK1 (MKNK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details