Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGEF10L Peptide - C-terminal region

ARHGEF10L Peptide - C-terminal region

Product Specifications

Product Name Alternative

GrinchGEF

UniProt

Q9HCE6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARHGEF10L Rabbit Polyclonal Antibody (orb589158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001011722.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SILAPDILRSDQEEAEGPRAEEDKPDGQAHEPMPDSHVGRELTRKKGILL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCIF1 (NM_022104) Human Recombinant Protein
TP303430M 100 µg

PCIF1 (NM_022104) Human Recombinant Protein

Sign In for Pricing
View Details
Chromogranin A (CGA414 + CGA/777 + CGA/798), 1mg/mL
BNUM1060-50 1x 50 µL

Chromogranin A (CGA414 + CGA/777 + CGA/798), 1mg/mL

Sign In for Pricing
View Details
APC Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187E-01 50 Tests

APC Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details
APC Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187E-02 100 Tests

APC Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details
APC Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187E-03 2x 100 Tests

APC Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS631373 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details