Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA25 Peptide - middle region

SPATA25 Peptide - middle region

Product Specifications

Product Name Alternative

TSG23, C20orf165, dJ337O18.8

UniProt

Q9BR10

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPATA25 Rabbit Polyclonal Antibody (orb55778) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542175.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRQLESLGWDNGYSRSRAPDLGGPSRPRPLMLCGLSPRVLPVPSEAVGKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLACP (COL25A1) Human Gene Knockout Kit (CRISPR)
KN417472 1 Kit

CLACP (COL25A1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Nitro-4-chlorodiphenyl Ether
TRC-N495800-25G 25 g

2-Nitro-4-chlorodiphenyl Ether

Sign In for Pricing
View Details
ProteoSpin Urine Protein Concentration Midi Kit
52300 10 Preparations

ProteoSpin Urine Protein Concentration Midi Kit

Sign In for Pricing
View Details
Delta-Decalactone
TRC-D212350-1G 1 g

Delta-Decalactone

Sign In for Pricing
View Details
Benzyl Acetate
TRC-B222625-1G 1 g

Benzyl Acetate

Sign In for Pricing
View Details
FABP3 Mouse Monoclonal Antibody [Clone ID: OTI8G5]
CF813963 100 µg

FABP3 Mouse Monoclonal Antibody [Clone ID: OTI8G5]

Sign In for Pricing
View Details