Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM3A Peptide - C-terminal region

FAM3A Peptide - C-terminal region

Product Specifications

Product Name Alternative

DLD, 2.19, XAP-7, DXS560S

UniProt

P98173

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAM3A Rabbit Polyclonal Antibody (orb580810) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001164603.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAK Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV659869 1.0 µg DNA

MAK Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Guinea Pig Carnitine Acylcarnitine Translocase ELISA Kit
MBS7257661-01 48 Well

Guinea Pig Carnitine Acylcarnitine Translocase ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Carnitine Acylcarnitine Translocase ELISA Kit
MBS7257661-02 96 Well

Guinea Pig Carnitine Acylcarnitine Translocase ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Carnitine Acylcarnitine Translocase ELISA Kit
MBS7257661-03 5x 96 Well

Guinea Pig Carnitine Acylcarnitine Translocase ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Carnitine Acylcarnitine Translocase ELISA Kit
MBS7257661-04 10x 96 Well

Guinea Pig Carnitine Acylcarnitine Translocase ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Bend6 shRNA (UAS) - Lentiviral mouse Bend6 shRNA (UAS) (100)
GTR15248382 1 Vial

Lentiviral mouse Bend6 shRNA (UAS) - Lentiviral mouse Bend6 shRNA (UAS) (100)

Sign In for Pricing
View Details