FAM3A Peptide - C-terminal region
FAM3A Peptide - C-terminal region
Product Specifications
Product Name Alternative
DLD, 2.19, XAP-7, DXS560S
UniProt
P98173
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FAM3A Rabbit Polyclonal Antibody (orb580810) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001164603.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP3-28680-100ug 100 µg
CHO Monoclonal Desmoglein-3 Antibody (Forerunner patent anti-DSG3) - Humanized - (Dry Ice)
Sign In for Pricing
View Details 
