Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAQR4 Peptide - C-terminal region

PAQR4 Peptide - C-terminal region

Product Specifications

UniProt

Q8N4S7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAQR4 Rabbit Polyclonal Antibody (orb581875) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001271440.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSGAPGSLPCYLRMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC6 Antibody
KC-7803-01 50 μL

SIGLEC6 Antibody

Sign In for Pricing
View Details
SIGLEC6 Antibody
KC-7803-02 100 µL

SIGLEC6 Antibody

Sign In for Pricing
View Details
SIGLEC6 Antibody
KC-7803-03 1 mL

SIGLEC6 Antibody

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/1902), Biotin conjugate, 0.1mg/mL
BNCB1902-500 1x 500 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/1902), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-Lactic Acid
TRC-L113485-250MG 250 mg

D-Lactic Acid

Sign In for Pricing
View Details
SKOR1 Human Gene Knockout Kit (CRISPR)
KN415416 1 Kit

SKOR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details