PAQR4 Peptide - C-terminal region
PAQR4 Peptide - C-terminal region
Product Specifications
UniProt
Q8N4S7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PAQR4 Rabbit Polyclonal Antibody (orb581875) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001271440.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSGAPGSLPCYLRMD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-D459100-50MG 50 mg
(2R,3R,4S,5R)-1,2:4,5-Di-O-isopropylidene-3-nonadecanol
Sign In for Pricing
View Details 
BNUB0701-100 1x 100 µL
Melanoma Marker (HMB45 + M2-7C10 + M2-9E3 + T311), 0.2mg/mL
Sign In for Pricing
View Details 
P017-5MG 1x 1000 µL
CD81 (Mouse/Rat) Recombinant Monoclonal Hamster Antibody (24MS04.81) – Biotium Choice
Sign In for Pricing
View Details 
