PIM1 Peptide - N-terminal region
PIM1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
PIM
UniProt
P11309
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PIM1 Rabbit Polyclonal Antibody (orb583140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001230115.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
244490 100 µg
CDH11 (Cadherin 11, Type 2, OB-Cadherin (Osteoblast), CAD11, CDHOB, OB, OSF-4)
Sign In for Pricing
View Details 
GTR15178394 1 Vial
Lentiviral mouse Zfp738 shRNA (UAS) - Lentiviral mouse Zfp738 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details 
bsm-61087R-RBITC-01 20 µL
Galectin 3 Recombinant Antibody, RBITC Conjugated
Sign In for Pricing
View Details bsm-61087R-RBITC-02 100 µL
Galectin 3 Recombinant Antibody, RBITC Conjugated
Sign In for Pricing
View Details