Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIM1 Peptide - N-terminal region

PIM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PIM

UniProt

P11309

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIM1 Rabbit Polyclonal Antibody (orb583140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001230115.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-FLT3 (Y842) Antibody
CSB-PA008340-01 50 µg

Phospho-FLT3 (Y842) Antibody

Sign In for Pricing
View Details
Phospho-FLT3 (Y842) Antibody
CSB-PA008340-02 100 µg

Phospho-FLT3 (Y842) Antibody

Sign In for Pricing
View Details
ALDH3A1 Antibody
A12388-100UG 100 µg

ALDH3A1 Antibody

Sign In for Pricing
View Details
Human CD28 Protein, His Tag
orb1826878-01 10 µg

Human CD28 Protein, His Tag

Sign In for Pricing
View Details
Human CD28 Protein, His Tag
orb1826878-02 50 µg

Human CD28 Protein, His Tag

Sign In for Pricing
View Details
Human CD28 Protein, His Tag
orb1826878-03 100 µg

Human CD28 Protein, His Tag

Sign In for Pricing
View Details