Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIM1 Peptide - N-terminal region

PIM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PIM

UniProt

P11309

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIM1 Rabbit Polyclonal Antibody (orb583140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001230115.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-LGALS9-2-SV40-Neo Plasmid
PVT51550 2 µg

pCMV-LGALS9-2-SV40-Neo Plasmid

Sign In for Pricing
View Details
Anti-PKD2 antibody
STJ95138 200 µl

Anti-PKD2 antibody

Sign In for Pricing
View Details
SIRT3 (Sirtuin Type 3, SIR2L3) (MaxLight 750)
MBS6437659-01 0.1 mL

SIRT3 (Sirtuin Type 3, SIR2L3) (MaxLight 750)

Sign In for Pricing
View Details
SIRT3 (Sirtuin Type 3, SIR2L3) (MaxLight 750)
MBS6437659-02 5x 0.1 mL

SIRT3 (Sirtuin Type 3, SIR2L3) (MaxLight 750)

Sign In for Pricing
View Details
SSX2B Rabbit Polyclonal Antibody (Biotin)
orb2110450 100 µL

SSX2B Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Neuroglycan C Polyclonal Antibody
ABP51932-01 30 µL

Neuroglycan C Polyclonal Antibody

Sign In for Pricing
View Details