Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPNS2 Peptide - middle region

CAPNS2 Peptide - middle region

Product Specifications

UniProt

Q96L46

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPNS2 Rabbit Polyclonal Antibody (orb584674) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115706.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPF40B (NM_001031698) Human Recombinant Protein
TP309144L 1 mg

PRPF40B (NM_001031698) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-GOT2 Polyclonal Antibody
HF788014-01 50 µg

Anti-GOT2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GOT2 Polyclonal Antibody
HF788014-02 100 µg

Anti-GOT2 Polyclonal Antibody

Sign In for Pricing
View Details
THUMPD2 Rabbit Polyclonal Antibody
orb580586 100 µL

THUMPD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CD58/LFA-3 Affinity Purified Polyclonal Ab
AF1689-SP 25 µg

Human CD58/LFA-3 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Olr1596 Protein Vector (Rat) (pPM-C-His)
PV288685 500 ng

Olr1596 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details