Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPNS2 Peptide - middle region

CAPNS2 Peptide - middle region

Product Specifications

UniProt

Q96L46

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPNS2 Rabbit Polyclonal Antibody (orb584674) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115706.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal KAT3B/p300 Antibody (RW128)
NB100-507SS 0.05 mL

Mouse Monoclonal KAT3B/p300 Antibody (RW128)

Sign In for Pricing
View Details
NOLC1 (Nucleolar and Coiled-body Phosphoprotein 1, KIAA0035, NOPP130, NOPP140, NS5ATP13, P130) (FITC)
249399-FITC 100 µL

NOLC1 (Nucleolar and Coiled-body Phosphoprotein 1, KIAA0035, NOPP130, NOPP140, NS5ATP13, P130) (FITC)

Sign In for Pricing
View Details
SIM1 (NM_005068) Human Over-expression Lysate
LH07508V 100 µg

SIM1 (NM_005068) Human Over-expression Lysate

Sign In for Pricing
View Details
RRBP1 (NM_001042576) Human Tagged Lenti ORF Clone
RC218816L3 10 µg

RRBP1 (NM_001042576) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NMT2 Antibody Blocking peptide
orb1455897 500 µg

NMT2 Antibody Blocking peptide

Sign In for Pricing
View Details
Rabbit Anti SIRT6 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA)
IRBAMLSIRT6AP592200UL 1 Each

Rabbit Anti SIRT6 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA)

Sign In for Pricing
View Details