Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDI2 Peptide - N-terminal region

DDI2 Peptide - N-terminal region

Product Specifications

UniProt

Q5TDH0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDI2 Rabbit Polyclonal Antibody (orb589162) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115717.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQKENA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IGFBP-2 MAb (Clone 92320)
MAB674-SP 25 µg

Human IGFBP-2 MAb (Clone 92320)

Sign In for Pricing
View Details
Mouse tRNA-dihydrouridine synthase 1-like, DUS1L ELISA Kit
MBS9335497-01 48 Well

Mouse tRNA-dihydrouridine synthase 1-like, DUS1L ELISA Kit

Sign In for Pricing
View Details
Mouse tRNA-dihydrouridine synthase 1-like, DUS1L ELISA Kit
MBS9335497-02 96 Well

Mouse tRNA-dihydrouridine synthase 1-like, DUS1L ELISA Kit

Sign In for Pricing
View Details
Mouse tRNA-dihydrouridine synthase 1-like, DUS1L ELISA Kit
MBS9335497-03 5x 96 Well

Mouse tRNA-dihydrouridine synthase 1-like, DUS1L ELISA Kit

Sign In for Pricing
View Details
Mouse tRNA-dihydrouridine synthase 1-like, DUS1L ELISA Kit
MBS9335497-04 10x 96 Well

Mouse tRNA-dihydrouridine synthase 1-like, DUS1L ELISA Kit

Sign In for Pricing
View Details
Rb Rabbit pAb
E47R22267 100 µL

Rb Rabbit pAb

Sign In for Pricing
View Details