DDI2 Peptide - N-terminal region
DDI2 Peptide - N-terminal region
Product Specifications
UniProt
Q5TDH0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DDI2 Rabbit Polyclonal Antibody (orb589162) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_115717.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQKENA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS600179-01 0.1 mL
CIP2A (Cancerous Inhibitor of Protein Phosphatase 2A, p90)
Sign In for Pricing
View Details MBS600179-02 5x 0.1 mL
CIP2A (Cancerous Inhibitor of Protein Phosphatase 2A, p90)
Sign In for Pricing
View Details ![Rabbit Monoclonal SATB2 Antibody (SATB2/8697R) [DyLight 550]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
NBP3-21055R 0.1 mL
Rabbit Monoclonal SATB2 Antibody (SATB2/8697R) [DyLight 550]
Sign In for Pricing
View Details ![Rabbit Polyclonal VPS26A Antibody [Alexa Fluor 350]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP2-97752AF350 0.1 mL
Rabbit Polyclonal VPS26A Antibody [Alexa Fluor 350]
Sign In for Pricing
View Details 