Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERBB4 Peptide - C-terminal region

ERBB4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HER4, ALS19, p180erbB4

UniProt

Q53T57

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERBB4 Rabbit Polyclonal Antibody (orb589165) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001036064.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse APCDD1 Protein CF
9981-AP-050 50 µg

Recombinant Mouse APCDD1 Protein CF

Sign In for Pricing
View Details
HIST1H1B Antibody
orb416572-01 50 μL

HIST1H1B Antibody

Sign In for Pricing
View Details
HIST1H1B Antibody
orb416572-02 100 µL

HIST1H1B Antibody

Sign In for Pricing
View Details
PUS7 shRNA Plasmid (m)
sc-152594-SH 20 µg

PUS7 shRNA Plasmid (m)

Sign In for Pricing
View Details
GENLISA™ Horse Vitamin D Binding Protein (DBP)ELISA
KLV0194 1x 96 Well

GENLISA™ Horse Vitamin D Binding Protein (DBP)ELISA

Sign In for Pricing
View Details
Porcine A Disintegrin And Metalloproteinase With Thrombospondin Motifs 1 (ADAMTS1) ELISA Kit
MBS7260455-01 48 Well

Porcine A Disintegrin And Metalloproteinase With Thrombospondin Motifs 1 (ADAMTS1) ELISA Kit

Sign In for Pricing
View Details