Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERBB4 Peptide - C-terminal region

ERBB4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HER4, ALS19, p180erbB4

UniProt

Q53T57

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERBB4 Rabbit Polyclonal Antibody (orb589166) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001036064.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAEDEY

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cluster of Differentiation 300A (CD300A) ELISA Kit
IHUCD300AKT 1 Each

Human Cluster of Differentiation 300A (CD300A) ELISA Kit

Sign In for Pricing
View Details
Recombinant Ceratophyllum demersum Photosystem I assembly protein ycf3 (ycf3)
MBS1103829-01 0.02 mg (E-Coli)

Recombinant Ceratophyllum demersum Photosystem I assembly protein ycf3 (ycf3)

Sign In for Pricing
View Details
Recombinant Ceratophyllum demersum Photosystem I assembly protein ycf3 (ycf3)
MBS1103829-02 0.1 mg (E-Coli)

Recombinant Ceratophyllum demersum Photosystem I assembly protein ycf3 (ycf3)

Sign In for Pricing
View Details
Recombinant Ceratophyllum demersum Photosystem I assembly protein ycf3 (ycf3)
MBS1103829-03 0.02 mg (Yeast)

Recombinant Ceratophyllum demersum Photosystem I assembly protein ycf3 (ycf3)

Sign In for Pricing
View Details
Recombinant Ceratophyllum demersum Photosystem I assembly protein ycf3 (ycf3)
MBS1103829-04 0.1 mg (Yeast)

Recombinant Ceratophyllum demersum Photosystem I assembly protein ycf3 (ycf3)

Sign In for Pricing
View Details
Recombinant Ceratophyllum demersum Photosystem I assembly protein ycf3 (ycf3)
MBS1103829-05 0.02 mg (Baculovirus)

Recombinant Ceratophyllum demersum Photosystem I assembly protein ycf3 (ycf3)

Sign In for Pricing
View Details