Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP12 Peptide - middle region

MMP12 Peptide - middle region

Product Specifications

Product Name Alternative

ME, HME, MME, MMP-12

UniProt

P39900

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMP12 Rabbit Polyclonal Antibody (orb589172) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002417.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFFFKDRF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 15 (CLDN15) (Center) Rabbit Polyclonal Antibody
AP50942PU-N 400 µL

Claudin 15 (CLDN15) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARC Antibody
8C0130-AAT 50 µg

ARC Antibody

Sign In for Pricing
View Details
Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)
PDMR100107-01 20 µg

Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)
PDMR100107-02 100 µg

Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)
PDMR100107-03 500 µg

Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)
PDMR100107-04 1 mg

Recombinant Rat TNF-α Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details