Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTRA2 Peptide - middle region

HTRA2 Peptide - middle region

Product Specifications

Product Name Alternative

OMI, PARK13, PRSS25

UniProt

O43464

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HTRA2 Rabbit Polyclonal Antibody (orb589176) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037379.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat beta-Lactamase Inhibitor ELISA Kit
MBS026145-01 48 Well

Rat beta-Lactamase Inhibitor ELISA Kit

Sign In for Pricing
View Details
Rat beta-Lactamase Inhibitor ELISA Kit
MBS026145-02 96 Well

Rat beta-Lactamase Inhibitor ELISA Kit

Sign In for Pricing
View Details
Rat beta-Lactamase Inhibitor ELISA Kit
MBS026145-03 5x 96 Well

Rat beta-Lactamase Inhibitor ELISA Kit

Sign In for Pricing
View Details
Rat beta-Lactamase Inhibitor ELISA Kit
MBS026145-04 10x 96 Well

Rat beta-Lactamase Inhibitor ELISA Kit

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S-trimer Protein
MBS2567780-01 0.05 mg

Recombinant SARS-CoV-2 S-trimer Protein

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S-trimer Protein
MBS2567780-02 0.1 mg

Recombinant SARS-CoV-2 S-trimer Protein

Sign In for Pricing
View Details