FZD10 Peptide - C-terminal region
FZD10 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Fz10, FzE7, CD350, FZ-10, hFz10
UniProt
Q9ULW2
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FZD10 Rabbit Polyclonal Antibody (orb577978) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_009128.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![(2S,3S,5S)-5-[(N-Formyl-L-leucyl)oxy]-2-hexyl-3-hydroxyhexadecanoic Acid (Orlistat Impurity) (>80%)](https://cdn.genprice.uk/products/572/5579308748149/imageurl/trc-f700600-50mg.webp)
TRC-F700600-50MG 50 mg
(2S,3S,5S)-5-[(N-Formyl-L-leucyl)oxy]-2-hexyl-3-hydroxyhexadecanoic Acid (Orlistat Impurity) (>80%)
Sign In for Pricing
View Details 
