FZD10 Peptide - C-terminal region
FZD10 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Fz10, FzE7, CD350, FZ-10, hFz10
UniProt
Q9ULW2
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FZD10 Rabbit Polyclonal Antibody (orb577978) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_009128.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![FH Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F10]](https://cdn.genprice.uk/products/937/6868c319994c49e6dc3eed2f/imageurl/ta500675bm.webp)
TA500675BM 100 µL
FH Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F10]
Sign In for Pricing
View Details 
LC424874 20 µg
Glucocorticoid Receptor (NR3C1) (NM_000176) Human Over-expression Lysate
Sign In for Pricing
View Details ![FLT4 Mouse Monoclonal Antibody [Clone ID: OTI1G7]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907f90/imageurl/cf806894.webp)
