Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP48 Peptide - N-terminal region

USP48 Peptide - N-terminal region

Product Specifications

Product Name Alternative

USP31, RAP1GA1

UniProt

Q86UV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP48 Rabbit Polyclonal Antibody (orb579292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001027902.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NTFLQVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

StARD13 (H-10) HRP
sc-377054 HRP 200 µg/mL

StARD13 (H-10) HRP

Sign In for Pricing
View Details
3-Amino-2-chloro-4-methylpyridine
A1376-48 5 g

3-Amino-2-chloro-4-methylpyridine

Sign In for Pricing
View Details
Cpne6 (NM_001146183) Mouse Tagged ORF Clone Lentiviral Particle
MR217305L4V 200 µL

Cpne6 (NM_001146183) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Hsa-miR-6847-5p miRNA Mimic
orb1876397-01 5 nmol

Hsa-miR-6847-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-6847-5p miRNA Mimic
orb1876397-02 10 nmol

Hsa-miR-6847-5p miRNA Mimic

Sign In for Pricing
View Details
OR5M7P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
35470061 1.0 µg DNA

OR5M7P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details