Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP48 Peptide - N-terminal region

USP48 Peptide - N-terminal region

Product Specifications

Product Name Alternative

USP31, RAP1GA1

UniProt

Q86UV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP48 Rabbit Polyclonal Antibody (orb579292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001027902.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NTFLQVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine asialoglyco protein receptor (ASGPR) antibody ELISA Kit
MBS7212758-01 48 Well

Bovine asialoglyco protein receptor (ASGPR) antibody ELISA Kit

Sign In for Pricing
View Details
Bovine asialoglyco protein receptor (ASGPR) antibody ELISA Kit
MBS7212758-02 96 Well

Bovine asialoglyco protein receptor (ASGPR) antibody ELISA Kit

Sign In for Pricing
View Details
Bovine asialoglyco protein receptor (ASGPR) antibody ELISA Kit
MBS7212758-03 5x 96 Well

Bovine asialoglyco protein receptor (ASGPR) antibody ELISA Kit

Sign In for Pricing
View Details
Bovine asialoglyco protein receptor (ASGPR) antibody ELISA Kit
MBS7212758-04 10x 96 Well

Bovine asialoglyco protein receptor (ASGPR) antibody ELISA Kit

Sign In for Pricing
View Details
Human SBDS / Ribosome maturation protein SBDS ELISA Kit
MBS2905527-01 48 Well

Human SBDS / Ribosome maturation protein SBDS ELISA Kit

Sign In for Pricing
View Details
Human SBDS / Ribosome maturation protein SBDS ELISA Kit
MBS2905527-02 96 Well

Human SBDS / Ribosome maturation protein SBDS ELISA Kit

Sign In for Pricing
View Details