Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT12 Peptide - middle region

TRMT12 Peptide - middle region

Product Specifications

Product Name Alternative

TYW2, TRM12

UniProt

Q53H54

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRMT12 Rabbit Polyclonal Antibody (orb589018) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060426.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEHWLYPQQITTNQWKNGATRDSRGKMLSPATKPEWQRWAESAETRIATL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MULTI-BLOT REPLICATOR, Frozen Specimen, Floating, E-Clip Style, 96 Wells, Deep Well Plate, Slot Tip Delivers ~2,000nL Hanging Drop, 1.58mm Pin Diameter, 45mm Exposed Pin Length, Spring-Loaded
VP 408FS2AS-1 1 Each

MULTI-BLOT REPLICATOR, Frozen Specimen, Floating, E-Clip Style, 96 Wells, Deep Well Plate, Slot Tip Delivers ~2,000nL Hanging Drop, 1.58mm Pin Diameter, 45mm Exposed Pin Length, Spring-Loaded

Sign In for Pricing
View Details
General Calcitroic Acid (CA) CLIA Kit
MBS2707961-01 24 Strip Well

General Calcitroic Acid (CA) CLIA Kit

Sign In for Pricing
View Details
General Calcitroic Acid (CA) CLIA Kit
MBS2707961-02 48 Well

General Calcitroic Acid (CA) CLIA Kit

Sign In for Pricing
View Details
General Calcitroic Acid (CA) CLIA Kit
MBS2707961-03 96 Well

General Calcitroic Acid (CA) CLIA Kit

Sign In for Pricing
View Details
General Calcitroic Acid (CA) CLIA Kit
MBS2707961-04 5x 96 Well

General Calcitroic Acid (CA) CLIA Kit

Sign In for Pricing
View Details
General Calcitroic Acid (CA) CLIA Kit
MBS2707961-05 10x 96 Well

General Calcitroic Acid (CA) CLIA Kit

Sign In for Pricing
View Details