COBL Peptide - middle region
COBL Peptide - middle region
Product Specifications
UniProt
O75128
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with COBL Rabbit Polyclonal Antibody (orb589021) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001274365.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SVGQSCGFSGKQSTSSQEASSASEPRRAPDGTDPPPPHTSDTQACSRELV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15161139 1 Vial
Lentiviral human ZBTB11 shRNA (UAS) - Lentiviral human ZBTB11 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
MBS6401694-01 0.1 mL
PMEL (Melanocyte Protein PMEL, ME20-M, ME20M, Melanocyte Protein Pmel 17, Melanocytes Lineage-specific Antigen GP100, Melanoma-associated ME20 Antigen, P1, P100, Premelanosome Protein, Silver Locus Protein Homolog, D12S53E, PMEL17, SILV) (Biotin)
Sign In for Pricing
View Details MBS6401694-02 5x 0.1 mL
PMEL (Melanocyte Protein PMEL, ME20-M, ME20M, Melanocyte Protein Pmel 17, Melanocytes Lineage-specific Antigen GP100, Melanoma-associated ME20 Antigen, P1, P100, Premelanosome Protein, Silver Locus Protein Homolog, D12S53E, PMEL17, SILV) (Biotin)
Sign In for Pricing
View Details 
MBS1132647-01 0.02 mg (E-Coli)
Recombinant Janthinobacterium sp. UPF0246 protein mma_1385 (mma_1385)
Sign In for Pricing
View Details MBS1132647-02 0.02 mg (Yeast)
Recombinant Janthinobacterium sp. UPF0246 protein mma_1385 (mma_1385)
Sign In for Pricing
View Details