COBL Peptide - middle region
COBL Peptide - middle region
Product Specifications
UniProt
O75128
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with COBL Rabbit Polyclonal Antibody (orb589021) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001274365.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SVGQSCGFSGKQSTSSQEASSASEPRRAPDGTDPPPPHTSDTQACSRELV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RG047S 100 Tests
Bio-LumiTM Steady II Firefly Luciferase Reporter Gene Assay Kit
Sign In for Pricing
View Details 
GTR15243099 1 Vial
Lentiviral mouse Rad9a shRNA (UAS) - Lentiviral mouse Rad9a shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
TMAB-02040G-01 500 μL
Rabbit Anti-Guinea Pig IgG H&L Secondary Antibody-Gold
Sign In for Pricing
View Details