Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG101 Peptide - N-terminal region

ATG101 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C12orf44

UniProt

Q9BSB4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG101 Rabbit Polyclonal Antibody (orb589110) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001092143.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TLR6 ELISA Kit
orb442616-01 48 Tests

Human TLR6 ELISA Kit

Sign In for Pricing
View Details
Human TLR6 ELISA Kit
orb442616-02 96 Tests

Human TLR6 ELISA Kit

Sign In for Pricing
View Details
IL2 Receptor beta (IL2RB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B5]
TA812261BM 100 µL

IL2 Receptor beta (IL2RB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B5]

Sign In for Pricing
View Details
SsuD Antibody
orb832599 2 mg

SsuD Antibody

Sign In for Pricing
View Details
RPS6 (Ribosomal Protein S6) discontinued
213191-01 20 µL

RPS6 (Ribosomal Protein S6) discontinued

Sign In for Pricing
View Details
RPS6 (Ribosomal Protein S6) discontinued
213191-02 100 µL

RPS6 (Ribosomal Protein S6) discontinued

Sign In for Pricing
View Details