Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG101 Peptide - N-terminal region

ATG101 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C12orf44

UniProt

Q9BSB4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG101 Rabbit Polyclonal Antibody (orb589110) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001092143.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sicastar®-greenF plain
42-00-202 10 mL

Sicastar®-greenF plain

Sign In for Pricing
View Details
Cortisol Binding Globulin Protein, Human, Recombinant (His Tag)
MBS8120621-01 0.1 mg

Cortisol Binding Globulin Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Cortisol Binding Globulin Protein, Human, Recombinant (His Tag)
MBS8120621-02 5x 0.1 mg

Cortisol Binding Globulin Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Epn1 AAV siRNA Pooled Vector
19373164 1.0 µg

Epn1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ITM2BP1 3'UTR GFP Stable Cell Line
TU061356 1.0 mL

ITM2BP1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
OCIAD2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
32430111 3x 1.0 µg

OCIAD2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details