Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUSC1 Peptide - middle region

RUSC1 Peptide - middle region

Product Specifications

Product Name Alternative

NESCA

UniProt

Q9BVN2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RUSC1 Rabbit Polyclonal Antibody (orb589117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001098673.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEWKTTENNNTGWKNNGNVNSSWKSEPEKFDSGWKTNTRITDSGSKTDAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pspn shRNA (UAS) - Lentiviral mouse Pspn shRNA (UAS) (100)
GTR15234150 1 Vial

Lentiviral mouse Pspn shRNA (UAS) - Lentiviral mouse Pspn shRNA (UAS) (100)

Sign In for Pricing
View Details
LRP6 Polyclonal Antibody
JOT-AP10976-01 20 µL

LRP6 Polyclonal Antibody

Sign In for Pricing
View Details
LRP6 Polyclonal Antibody
JOT-AP10976-02 50 μL

LRP6 Polyclonal Antibody

Sign In for Pricing
View Details
LRP6 Polyclonal Antibody
JOT-AP10976-03 100 µL

LRP6 Polyclonal Antibody

Sign In for Pricing
View Details
160 kDa Neurofilament antibody
10R-8098 0.1 mg

160 kDa Neurofilament antibody

Sign In for Pricing
View Details
ALK-IN-26
T77754-01 1 mg

ALK-IN-26

Sign In for Pricing
View Details