RUSC1 Peptide - middle region
RUSC1 Peptide - middle region
Product Specifications
Product Name Alternative
NESCA
UniProt
Q9BVN2
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RUSC1 Rabbit Polyclonal Antibody (orb589117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001098673.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AEWKTTENNNTGWKNNGNVNSSWKSEPEKFDSGWKTNTRITDSGSKTDAG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2546407 100 µL
Microcephalin 1/BRIT1 Rabbit Polyclonal Antibody (BF680)
Sign In for Pricing
View Details 
130551-ML650 100 µL
NR2F2 (COUP Transcription Factor 2, COUP-TF2, Apolipoprotein A-I Regulatory Protein 1, ARP-1, COUP Transcription Factor II, COUP-TF II, Nuclear Receptor Subfamily 2 Group F Member 2, ARP1, TFCOUP2) (MaxLight 650)
Sign In for Pricing
View Details 
YP-W16634-01 48 Tests
Human Apoptosis-associated speck-like protein containing a CARD (PYCARD) ELISA Kit
Sign In for Pricing
View Details YP-W16634-02 96 Tests
Human Apoptosis-associated speck-like protein containing a CARD (PYCARD) ELISA Kit
Sign In for Pricing
View Details