JPT2 Peptide - middle region
JPT2 Peptide - middle region
Product Specifications
Product Name Alternative
L11, HN1L, C16orf34
UniProt
Q9H910
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with JPT2 Rabbit Polyclonal Antibody (orb589179) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_653171.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGK
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940849-500 1x 500 µL
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ber-H2 + CD30/412), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 