Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JPT2 Peptide - middle region

JPT2 Peptide - middle region

Product Specifications

Product Name Alternative

L11, HN1L, C16orf34

UniProt

Q9H910

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with JPT2 Rabbit Polyclonal Antibody (orb589179) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653171.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGK

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-IKB epsilon (Ser22) Polyclonal Antibody, Cy5.5 Conjugated
bs-15582R-Cy5.5 100 µL

Phospho-IKB epsilon (Ser22) Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
YWHAE Rabbit Polyclonal Antibody (APC)
orb2593634 100 µg

YWHAE Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Rat Phospholipase D2 ELISA Kit
MBS2884993-01 48 Well

Rat Phospholipase D2 ELISA Kit

Sign In for Pricing
View Details
Rat Phospholipase D2 ELISA Kit
MBS2884993-02 96 Well

Rat Phospholipase D2 ELISA Kit

Sign In for Pricing
View Details
Rat Phospholipase D2 ELISA Kit
MBS2884993-03 5x 96 Well

Rat Phospholipase D2 ELISA Kit

Sign In for Pricing
View Details
Rat Phospholipase D2 ELISA Kit
MBS2884993-04 10x 96 Well

Rat Phospholipase D2 ELISA Kit

Sign In for Pricing
View Details