Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MR1 Peptide - N-terminal region

MR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HLALS

UniProt

Q95460

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MR1 Rabbit Polyclonal Antibody (orb589180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001181928.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slide Cabinet
KD-103 Each

Slide Cabinet

Sign In for Pricing
View Details
ACHE sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
11171111 3x 1.0 µg

ACHE sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CFLAR CRISPRa sgRNA lentivector (set of three targets)(Human)
15989121 3x 1.0µg DNA

CFLAR CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
PSI
MBS5773100 Inquire

PSI

Sign In for Pricing
View Details
NAT-14 Lentiviral Activation Particles (h2)
sc-408604-LAC-2 200 µL

NAT-14 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Methomyl Oxime
orb1226417-01 100 mg

Methomyl Oxime

Sign In for Pricing
View Details