Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BOD1 Peptide - middle region

BOD1 Peptide - middle region

Product Specifications

Product Name Alternative

FAM44B

UniProt

Q96IK1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BOD1 Rabbit Polyclonal Antibody (orb589186) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001153123.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPTMNKNQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Gucy2g shRNA (UAS) - Lentiviral mouse Gucy2g shRNA (UAS, iRFP) (25)
GTR15260702 1 Vial

Lentiviral mouse Gucy2g shRNA (UAS) - Lentiviral mouse Gucy2g shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
TOR1AIP2 Protein Vector (Mouse) (pPB-C-His)
PV240810 500 ng

TOR1AIP2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
FANCI Antibody
orb2675983-01 50 µL

FANCI Antibody

Sign In for Pricing
View Details
FANCI Antibody
orb2675983-02 100 µL

FANCI Antibody

Sign In for Pricing
View Details
FANCI Antibody
orb2675983-03 200 µL

FANCI Antibody

Sign In for Pricing
View Details
Olezarsen
HY-153491-01 1 mg

Olezarsen

Sign In for Pricing
View Details