Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BOD1 Peptide - middle region

BOD1 Peptide - middle region

Product Specifications

Product Name Alternative

FAM44B

UniProt

Q96IK1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BOD1 Rabbit Polyclonal Antibody (orb589186) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001153123.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPTMNKNQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf48 Rabbit Polyclonal Antibody (Cy7)
orb1062986 100 µL

C19orf48 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Hsa-miR-665 antagomir
HY-RI01989A-01 5 nmol

Hsa-miR-665 antagomir

Sign In for Pricing
View Details
Hsa-miR-665 antagomir
HY-RI01989A-02 20 nmol

Hsa-miR-665 antagomir

Sign In for Pricing
View Details
c-Kit Antibody
AF4701-01 50 µL

c-Kit Antibody

Sign In for Pricing
View Details
c-Kit Antibody
AF4701-02 100 µL

c-Kit Antibody

Sign In for Pricing
View Details
c-Kit Antibody
AF4701-03 200 µL

c-Kit Antibody

Sign In for Pricing
View Details