Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDELC1 Peptide - middle region

KDELC1 Peptide - middle region

Product Specifications

Product Name Alternative

EP58, ERp58, KDEL1

UniProt

Q6UW63

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KDELC1 Rabbit Polyclonal Antibody (orb589192) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076994.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VELFVNLGDWPLEKKKSNSNIHPIFSWCGSTDSKDIVMPTYDLTDSVLET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf13 Protein Vector (Human) (pPM-C-HA)
PV005103 500 ng

C16orf13 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
IRS4 Rabbit Polyclonal Antibody (Biotin)
orb2583992 100 µg

IRS4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
FAAH Protein Vector (Human) (pPB-C-His)
PV051797 500 ng

FAAH Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Research Grade Anti-Human IL2 (CUE101)
MBS1581439-01 0.1 mg

Research Grade Anti-Human IL2 (CUE101)

Sign In for Pricing
View Details
Research Grade Anti-Human IL2 (CUE101)
MBS1581439-02 1 mg

Research Grade Anti-Human IL2 (CUE101)

Sign In for Pricing
View Details
Research Grade Anti-Human IL2 (CUE101)
MBS1581439-03 5x 1 mg

Research Grade Anti-Human IL2 (CUE101)

Sign In for Pricing
View Details