Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDELC1 Peptide - middle region

KDELC1 Peptide - middle region

Product Specifications

Product Name Alternative

EP58, ERp58, KDEL1

UniProt

Q6UW63

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KDELC1 Rabbit Polyclonal Antibody (orb589192) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076994.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VELFVNLGDWPLEKKKSNSNIHPIFSWCGSTDSKDIVMPTYDLTDSVLET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain K12/DH10B) ACEK Polyclonal Antibody
MBS7184993 Inquire

Rabbit anti-Escherichia coli (strain K12/DH10B) ACEK Polyclonal Antibody

Sign In for Pricing
View Details
pCMV-C130071C03Rik-lncRNA-Neo Plasmid
PVT50242 2 µg

pCMV-C130071C03Rik-lncRNA-Neo Plasmid

Sign In for Pricing
View Details
L-AP3
sc-202201B 25 mg

L-AP3

Sign In for Pricing
View Details
PFKFB3/PFK2 Recombinant Antibody, Cy3 Conjugated
bsm-61693R-Cy3-TR 20 µL

PFKFB3/PFK2 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
AdmiRa-mmu-miR-98-5p-Off Virus
mm6050 1.0 mL

AdmiRa-mmu-miR-98-5p-Off Virus

Sign In for Pricing
View Details
TNF alpha (MaxLight 750)
MBS6257434-01 0.1 mL

TNF alpha (MaxLight 750)

Sign In for Pricing
View Details