Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNRH2 Peptide - middle region

GNRH2 Peptide - middle region

Product Specifications

Product Name Alternative

GnRH-II, LH-RHII

UniProt

O43555

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GNRH2 Rabbit Polyclonal Antibody (orb589195) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001297149.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLLLLLLTAHLGPSEAQHWSHGWYPGGKRALSSAQDPQNALRPPGRALDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nogo Receptor Rabbit mAb Antibody
orb1727079-01 50 µL

Nogo Receptor Rabbit mAb Antibody

Sign In for Pricing
View Details
Nogo Receptor Rabbit mAb Antibody
orb1727079-02 100 µL

Nogo Receptor Rabbit mAb Antibody

Sign In for Pricing
View Details
ALG8 Antibody (N-term) Blocking Peptide
MBS9223548-01 0.5 mg

ALG8 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
ALG8 Antibody (N-term) Blocking Peptide
MBS9223548-02 5x 0.5 mg

ALG8 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
Alpha Synuclein (Phospho-Ser129) Rabbit mAb
14154 50 µL

Alpha Synuclein (Phospho-Ser129) Rabbit mAb

Sign In for Pricing
View Details
Csgalnact1 (NM_172753) Mouse Tagged ORF Clone
MG208499 10 µg

Csgalnact1 (NM_172753) Mouse Tagged ORF Clone

Sign In for Pricing
View Details