Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNRH2 Peptide - middle region

GNRH2 Peptide - middle region

Product Specifications

Product Name Alternative

GnRH-II, LH-RHII

UniProt

O43555

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GNRH2 Rabbit Polyclonal Antibody (orb589195) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001297149.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLLLLLLTAHLGPSEAQHWSHGWYPGGKRALSSAQDPQNALRPPGRALDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipopolysaccharide Binding Protein (LBP) Polyclonal Antibody
CAU25993-01 100 µL

Lipopolysaccharide Binding Protein (LBP) Polyclonal Antibody

Sign In for Pricing
View Details
Lipopolysaccharide Binding Protein (LBP) Polyclonal Antibody
CAU25993-02 200 µL

Lipopolysaccharide Binding Protein (LBP) Polyclonal Antibody

Sign In for Pricing
View Details
Lipopolysaccharide Binding Protein (LBP) Polyclonal Antibody
CAU25993-03 1 mL

Lipopolysaccharide Binding Protein (LBP) Polyclonal Antibody

Sign In for Pricing
View Details
C4orf40 CRISPR/Cas9 KO Plasmid (h)
sc-415969 20 µg

C4orf40 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human IRF9 Protein - (Dry Ice)
H00010379-P01-25ug 25 µg

Recombinant Human IRF9 Protein - (Dry Ice)

Sign In for Pricing
View Details
Human ITGA5 Pre-designed siRNA Set B
SI007826B 1 Each

Human ITGA5 Pre-designed siRNA Set B

Sign In for Pricing
View Details