BRS3 Peptide - middle region
BRS3 Peptide - middle region
Product Specifications
Product Name Alternative
BB3
UniProt
P32247
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BRS3 Rabbit Polyclonal Antibody (orb589202) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001718.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
038451-ML405 100 µL
MKL1, ID (MKL1, KIAA1438, MAL, MKL/myocardin-like protein 1, Megakaryoblastic leukemia 1 protein, Megakaryocytic acute leukemia protein, Myocardin-related transcription factor A) (MaxLight 405) discontinued
Sign In for Pricing
View Details MBS1092822-01 0.02 mg (E-Coli)
Recombinant Prochlorococcus marinus ATP synthase epsilon chain (atpC)
Sign In for Pricing
View Details MBS1092822-02 0.1 mg (E-Coli)
Recombinant Prochlorococcus marinus ATP synthase epsilon chain (atpC)
Sign In for Pricing
View Details MBS1092822-03 0.02 mg (Yeast)
Recombinant Prochlorococcus marinus ATP synthase epsilon chain (atpC)
Sign In for Pricing
View Details MBS1092822-04 0.1 mg (Yeast)
Recombinant Prochlorococcus marinus ATP synthase epsilon chain (atpC)
Sign In for Pricing
View Details MBS1092822-05 0.02 mg (Baculovirus)
Recombinant Prochlorococcus marinus ATP synthase epsilon chain (atpC)
Sign In for Pricing
View Details