Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRS3 Peptide - middle region

BRS3 Peptide - middle region

Product Specifications

Product Name Alternative

BB3

UniProt

P32247

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRS3 Rabbit Polyclonal Antibody (orb589202) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001718.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DR4/TNFRSF10A Antibody Picoband®, PE Conjugate
PA1975-PE 100 µg/Vial

Anti-DR4/TNFRSF10A Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Immortalized Human Periodontal Ligament Cells - hTERT
T0767 1x106 cells / 1.0 mL

Immortalized Human Periodontal Ligament Cells - hTERT

Sign In for Pricing
View Details
EEA1 Rabbit mAb
RDSA65332 100 µL

EEA1 Rabbit mAb

Sign In for Pricing
View Details
SPRY4, CT (Protein Sprouty Homolog 4, Spry-4) (MaxLight 750) discontinued
S5620-25C-ML750 100 µL

SPRY4, CT (Protein Sprouty Homolog 4, Spry-4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ARMC8 (Armadillo Repeat-containing Protein 8, S863-2, DKFZP434A043, HSPC056, MGC10058, MGC4880) (HRP)
123549-HRP 100 µL

ARMC8 (Armadillo Repeat-containing Protein 8, S863-2, DKFZP434A043, HSPC056, MGC10058, MGC4880) (HRP)

Sign In for Pricing
View Details
Uracil Phosphoribosyltransferase (UPRT) BioAssayTM ELISA Kit (Human)
153225 96 Tests

Uracil Phosphoribosyltransferase (UPRT) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details