RAD51B Peptide - middle region
RAD51B Peptide - middle region
Product Specifications
Product Name Alternative
REC2, R51H2, RAD51L1
UniProt
A0A0A0
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAD51B Rabbit Polyclonal Antibody (orb589203) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002868.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC222120L2 10 µg
FBXO41 (NM_001080410) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details 
K0859502 1.0 µg DNA
GIYD2 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 
A00412-1-HRP 100 µg
Anti-PRDM1/Blimp1 Antibody Picoband® (HRP Conjugate)
Sign In for Pricing
View Details NBP2-74830DL594 0.1 mL
Mouse Monoclonal VASP Antibody (OTI4D6) [Dylight 594]
Sign In for Pricing
View Details MBS1332843-01 0.02 mg (E-Coli)
Recombinant Macaca fascicularis Ubiquitin-conjugating enzyme E2 U (UBE2U)
Sign In for Pricing
View Details