Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD51B Peptide - middle region

RAD51B Peptide - middle region

Product Specifications

Product Name Alternative

REC2, R51H2, RAD51L1

UniProt

A0A0A0

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAD51B Rabbit Polyclonal Antibody (orb589203) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002868.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,6,9,12-Tetrakis (Carboxymethyl) -3,6,9,12-Tetraazatetradecane-1,14-Dioic Acid
OR1010828-01 250 mg

3,6,9,12-Tetrakis (Carboxymethyl) -3,6,9,12-Tetraazatetradecane-1,14-Dioic Acid

Sign In for Pricing
View Details
3,6,9,12-Tetrakis (Carboxymethyl) -3,6,9,12-Tetraazatetradecane-1,14-Dioic Acid
OR1010828-02 1 g

3,6,9,12-Tetrakis (Carboxymethyl) -3,6,9,12-Tetraazatetradecane-1,14-Dioic Acid

Sign In for Pricing
View Details
3,6,9,12-Tetrakis (Carboxymethyl) -3,6,9,12-Tetraazatetradecane-1,14-Dioic Acid
OR1010828-03 5 g

3,6,9,12-Tetrakis (Carboxymethyl) -3,6,9,12-Tetraazatetradecane-1,14-Dioic Acid

Sign In for Pricing
View Details
3,6,9,12-Tetrakis (Carboxymethyl) -3,6,9,12-Tetraazatetradecane-1,14-Dioic Acid
OR1010828-04 25 g

3,6,9,12-Tetrakis (Carboxymethyl) -3,6,9,12-Tetraazatetradecane-1,14-Dioic Acid

Sign In for Pricing
View Details
Human TOP2B shRNA Plasmid
abx954907-01 150 µg

Human TOP2B shRNA Plasmid

Sign In for Pricing
View Details
Human TOP2B shRNA Plasmid
abx954907-02 300 µg

Human TOP2B shRNA Plasmid

Sign In for Pricing
View Details