NOX5 Peptide - C-terminal region
NOX5 Peptide - C-terminal region
Product Specifications
UniProt
Q96PH1
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NOX5 Rabbit Polyclonal Antibody (orb580880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001171708.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SLLTKLEMDQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANK
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2712703 1.0 µg DNA
ZNF532 sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 
MBS005699-01 48 Well
Canine Pleckstrin Homology Like Domain Family A Member 2 ELISA Kit
Sign In for Pricing
View Details MBS005699-02 96 Well
Canine Pleckstrin Homology Like Domain Family A Member 2 ELISA Kit
Sign In for Pricing
View Details MBS005699-03 5x 96 Well
Canine Pleckstrin Homology Like Domain Family A Member 2 ELISA Kit
Sign In for Pricing
View Details