Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOX5 Peptide - C-terminal region

NOX5 Peptide - C-terminal region

Product Specifications

UniProt

Q96PH1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOX5 Rabbit Polyclonal Antibody (orb580880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171708.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLLTKLEMDQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANK

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Fluoro DL-DOPA hydrobromide salt
FF23355 50 mg

6-Fluoro DL-DOPA hydrobromide salt

Sign In for Pricing
View Details
Rabbit Anti-Human RPP25L pAb
PA17118-01 50 μL

Rabbit Anti-Human RPP25L pAb

Sign In for Pricing
View Details
Rabbit Anti-Human RPP25L pAb
PA17118-02 100 μL

Rabbit Anti-Human RPP25L pAb

Sign In for Pricing
View Details
HDAC3, Active
MBS517064-01 0.01 mg

HDAC3, Active

Sign In for Pricing
View Details
HDAC3, Active
MBS517064-02 0.05 mg

HDAC3, Active

Sign In for Pricing
View Details
HDAC3, Active
MBS517064-03 0.5 mg

HDAC3, Active

Sign In for Pricing
View Details