Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYD88 Peptide - middle region

MYD88 Peptide - middle region

Product Specifications

Product Name Alternative

MYD88D

UniProt

Q99836

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYD88 Rabbit Polyclonal Antibody (orb584163) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001166037.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPALIN Antibody
orb2809210 100 µL

OPALIN Antibody

Sign In for Pricing
View Details
Mouse Prkg2 Pre-designed siRNA Set B
SI111159B 1 Each

Mouse Prkg2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
DMRTB Rabbit Polyclonal Antibody
MBS9514254-01 0.05 mL

DMRTB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DMRTB Rabbit Polyclonal Antibody
MBS9514254-02 0.1 mL

DMRTB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DMRTB Rabbit Polyclonal Antibody
MBS9514254-03 5x 0.1 mL

DMRTB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Oct-4 Rabbit pAb
APA2016-01 30 µL

Oct-4 Rabbit pAb

Sign In for Pricing
View Details