MYD88 Peptide - middle region
MYD88 Peptide - middle region
Product Specifications
Product Name Alternative
MYD88D
UniProt
Q99836
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MYD88 Rabbit Polyclonal Antibody (orb584163) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001166037.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1058042-01 0.02 mg (E-Coli)
Recombinant Mycobacterium tuberculosis Polyketide synthase-like Pks10 (pks10)
Sign In for Pricing
View Details MBS1058042-02 0.02 mg (Yeast)
Recombinant Mycobacterium tuberculosis Polyketide synthase-like Pks10 (pks10)
Sign In for Pricing
View Details MBS1058042-03 0.1 mg (E-Coli)
Recombinant Mycobacterium tuberculosis Polyketide synthase-like Pks10 (pks10)
Sign In for Pricing
View Details MBS1058042-04 0.1 mg (Yeast)
Recombinant Mycobacterium tuberculosis Polyketide synthase-like Pks10 (pks10)
Sign In for Pricing
View Details