Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRMT5 Peptide - C-terminal region

PRMT5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

JBP1, SKB1, IBP72, SKB1Hs, HRMT1L5

UniProt

O14744

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRMT5 Rabbit Polyclonal Antibody (orb588339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034708.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCRTR2 Antibody
E031252 100 µg -100 µL

HCRTR2 Antibody

Sign In for Pricing
View Details
CDC45 Antibody
A16754-50UL 50 μL

CDC45 Antibody

Sign In for Pricing
View Details
ECSCR AAV Vector (Human) (CMV)
18900101 1 µg

ECSCR AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
KIF2B (Kinesin Family Member 2B) (FITC)
MBS6447430-01 0.1 mL

KIF2B (Kinesin Family Member 2B) (FITC)

Sign In for Pricing
View Details
KIF2B (Kinesin Family Member 2B) (FITC)
MBS6447430-02 5x 0.1 mL

KIF2B (Kinesin Family Member 2B) (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal astacin-like metalloendopeptidase Antibody
NBP2-98076-50ul 50 µL

Rabbit Polyclonal astacin-like metalloendopeptidase Antibody

Sign In for Pricing
View Details