LCN2 Peptide - middle region
LCN2 Peptide - middle region
Product Specifications
Product Name Alternative
P25, 24p3, MSFI, NGAL
UniProt
X6R8F3
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LCN2 Rabbit Polyclonal Antibody (orb588906) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005555.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIY
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10411099 96 Well
Rabbit Anti Thyroid peroxidase antibody ELISA kit
Sign In for Pricing
View Details 
LV720481 1.0 µg DNA
CARS-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
Sign In for Pricing
View Details 