Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LCN2 Peptide - middle region

LCN2 Peptide - middle region

Product Specifications

Product Name Alternative

P25, 24p3, MSFI, NGAL

UniProt

X6R8F3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LCN2 Rabbit Polyclonal Antibody (orb588906) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005555.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIY

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Thyn1 (NM_144543) AAV Particle
MR202670A1V 250 µL

Mouse Thyn1 (NM_144543) AAV Particle

Sign In for Pricing
View Details
Anti-KIR2DL3 Antibody, Rabbit Polyclonal
MBS8106603-01 0.1 mL

Anti-KIR2DL3 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-KIR2DL3 Antibody, Rabbit Polyclonal
MBS8106603-02 5x 0.1 mL

Anti-KIR2DL3 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
RCC1L antibody
FNab09477 100 µg

RCC1L antibody

Sign In for Pricing
View Details
CORO2B Rabbit Polyclonal Antibody (PE)
orb487420 100 µL

CORO2B Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Recombinant Mouse Alcam/CD166 Protein, Fc Tag
E40MOP2068 20 µg

Recombinant Mouse Alcam/CD166 Protein, Fc Tag

Sign In for Pricing
View Details