Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GZMH Peptide - middle region

GZMH Peptide - middle region

Product Specifications

Product Name Alternative

CCP-X, CGL-2, CSP-C, CTLA1, CTSGL2

UniProt

P20718

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GZMH Rabbit Polyclonal Antibody (orb588907) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001257710.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

20(S)-Ginsenoside Rh2
TRC-G387585-25MG 25 mg

20(S)-Ginsenoside Rh2

Sign In for Pricing
View Details
Fmoc-Trp (Boc) Wang Resin
H0751501328.5G 5 g

Fmoc-Trp (Boc) Wang Resin

Sign In for Pricing
View Details
RRBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F1]
TA809626AM 100 µL

RRBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F1]

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS802386 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
Biotin Anti-Human/Mouse/Rat CD47 Antibody
RD20295F-01 25 µg

Biotin Anti-Human/Mouse/Rat CD47 Antibody

Sign In for Pricing
View Details
Biotin Anti-Human/Mouse/Rat CD47 Antibody
RD20295F-02 100 µg

Biotin Anti-Human/Mouse/Rat CD47 Antibody

Sign In for Pricing
View Details