Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPX1 Peptide - middle region

GPX1 Peptide - middle region

Product Specifications

Product Name Alternative

GPXD, GSHPX1

UniProt

A0A087WUQ6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPX1 Rabbit Polyclonal Antibody (orb588910) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000572.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Carboxypeptidase A2, Pancreatic (CPA2)
MBS2076207-01 0.1 mL

APC-Linked Polyclonal Antibody to Carboxypeptidase A2, Pancreatic (CPA2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Carboxypeptidase A2, Pancreatic (CPA2)
MBS2076207-02 0.2 mL

APC-Linked Polyclonal Antibody to Carboxypeptidase A2, Pancreatic (CPA2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Carboxypeptidase A2, Pancreatic (CPA2)
MBS2076207-03 0.5 mL

APC-Linked Polyclonal Antibody to Carboxypeptidase A2, Pancreatic (CPA2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Carboxypeptidase A2, Pancreatic (CPA2)
MBS2076207-04 1 mL

APC-Linked Polyclonal Antibody to Carboxypeptidase A2, Pancreatic (CPA2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Carboxypeptidase A2, Pancreatic (CPA2)
MBS2076207-05 5 mL

APC-Linked Polyclonal Antibody to Carboxypeptidase A2, Pancreatic (CPA2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Carboxypeptidase A2, Pancreatic (CPA2)
MBS2076207-06 5x 5 mL

APC-Linked Polyclonal Antibody to Carboxypeptidase A2, Pancreatic (CPA2)

Sign In for Pricing
View Details